PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G23870.1
Common NameLOC102719513
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 242aa    MW: 26590.3 Da    PI: 5.8718
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G23870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-193082456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  + +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  OB09G23870.1 30 KKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 82
                  456*************************************************9 PP

2HD-ZIP_I/II123.87.9e-4029120293
   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal ++ e+L+ke+++L ++l++
  OB09G23870.1  29 RKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLSSYESLKKEKHALIKQLEK 120
                   8**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-191786IPR009057Homeodomain-like
PROSITE profilePS5007117.072484IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-192791IPR009057Homeodomain-like
SMARTSM003891.8E-162788IPR001356Homeobox domain
CDDcd000861.88E-162985No hitNo description
PfamPF000467.5E-173082IPR001356Homeobox domain
PRINTSPR000317.9E-65564IPR000047Helix-turn-helix motif
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PRINTSPR000317.9E-66480IPR000047Helix-turn-helix motif
PfamPF021832.9E-1484125IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDGEEDSEWM MDLVVGGGKG GGKGGGADRK KRFSEEQIKS LESMFATQTK LEPRQKLQLA  60
RELGLQPRQV AIWFQNKRAR WKSKQLEREY SALRDDYDAL LSSYESLKKE KHALIKQLEK  120
LAEMLHEPPG KYGDNAGAGA GDGARSGGMK EEFVDARATL YSSTEGGGTA PKLVSHFGSD  180
DVDAGLFLRP SSQHTPHSAA AAAGGFTSSD PADHHSFNFH STWPSSTEQT CSSSQWWEFE  240
SE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0597550.0AK059755.1 Oryza sativa Japonica Group cDNA clone:006-203-C03, full insert sequence.
GenBankAK1031600.0AK103160.1 Oryza sativa Japonica Group cDNA clone:J033121C04, full insert sequence.
GenBankCT8308470.0CT830847.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN030P03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660877.11e-178PREDICTED: homeobox-leucine zipper protein HOX6-like
SwissprotQ651Z51e-123HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH351e-123HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLJ3MZF81e-178J3MZF8_ORYBR; Uncharacterized protein
STRINGOB09G23870.11e-178(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.13e-43homeobox 7